Protein coding transcript 220189

• Transcript: Ll_transcript_189686
• CDS coordinates: 1135-1476 (+)
• Peptide sequence: MLHDVVITGNNGTIDGIGSVWWDLFGSHSLNYSRPHLVEIVASRFVVVSNLTFLNAPAYSIHPVYCSHVHIQNVSISSPPESPCTVGIVPGLQHAMDSTFGPHYDNDHACNNI*
• ORF Type: complete

Annotations of Ll_transcript_189686

• Blastp: Probable polygalacturonase from Vitis with 49.44% of identity
• Blastx: Probable polygalacturonase from Vitis with 55.1% of identity
• Eggnog: Glycoside hydrolase family 28(COG5434)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419433.1)
• Pfam: Glycosyl hydrolases family 28 (PF00295.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;