Protein coding transcript 220202

• Transcript: Ll_transcript_189673
• CDS coordinates: 1122-1517 (+)
• Peptide sequence: MLNDVVITGNNGTIDGTGSIWWELFGSHSLNYSRPHLVEIVASEFVVVSNLTFLNAPAYSIHPVYCSHVHIHNVSISAPPESPYTVGIVPDSSDSICIEDCVVTMGYDAIALKSGWDEYGIAYGRPTENVHI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_189673

• Blastp: Probable polygalacturonase from Vitis with 51.91% of identity
• Blastx: Probable polygalacturonase from Vitis with 52.53% of identity
• Eggnog: Glycoside hydrolase family 28(COG5434)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425838.1)
• Pfam: Glycosyl hydrolases family 28 (PF00295.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;