Protein coding transcript 220307

• Transcript: Ll_transcript_190737
• CDS coordinates: 2-823 (+)
• Peptide sequence: TATIVSEQQAFPNNNSIRGLDVVNQIKTTVENACPGIVSCADILALAAQISSVLSNGPDWEVPLGRRDSLTANQTLANQNLPAPTLTLEQLKSAFSNQGLNTTDLVALSGAHTIGRAKCSSFIGRLYNFNSTGNPDQTLNTTLLQTLQALCPNNGPGTNLTNLDLTTPDTFDNNYYSNLQSQNGLLETDQVLFSTSGADTIAIVNNFINNQTLFYEKFKASMIKMGNIGVLTGSQGEIRTQCNFVNGNSSSTSSGLVTMITKESLEDGIVSSI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_190737

• Blastp: Peroxidase 54 from Arabidopsis with 60.62% of identity
• Blastx: Peroxidase 15 from Ipomoea with 65.83% of identity
• Eggnog: peroxidase(ENOG410YBAI)
• Kegg: Link to kegg annotations (AT5G06730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419109.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;