Protein coding transcript 220316

• Transcript: Ll_transcript_188708
• CDS coordinates: 3-656 (+)
• Peptide sequence: KGYWKATGNDRPVKHEQRIVGLKKTLVFHSGRAPDGKRTNWVMHEYRLVDEELEKARTANVSSQDAFVLCRVFHKNNIGPPNGQRYAPFVEEDWDDESGLVPGAQSAEPIFVAEQPCIESNDHVLCIEGRKDVEQDTQSVTKASFDVNKLPIETQSLLAVCKRESMAEFPSSPEKGDSKLMPDEYPSFQPDNHKAFSQIYKRRRYNLNNHLNASGDSI
• ORF Type: internal

Annotations of Ll_transcript_188708

• Blastp: NAC domain-containing protein 78 from Arabidopsis with 55.56% of identity
• Blastx: NAC domain-containing protein 78 from Arabidopsis with 55.56% of identity
• Eggnog: (NAC) domain-containing protein(ENOG410YG99)
• Kegg: Link to kegg annotations (AT5G04410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441018.1)
• Pfam: No apical meristem (NAM) protein (PF02365.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;