Transcript | Ll_transcript_188686 |
---|---|
CDS coordinates | 482-952 (+) |
Peptide sequence | MEKDAFVLCRVFHKNNIGPPNGQRYAPFVEEDWDDESGLVPGAQSAEPIFVAEQPCIESNDHVLCIEGRKDVEQDTQSVTKASFDVNKLPIETQSLLAVCKRESMAEFPSSPEKGDSKLMPDEYPSFQPDNHKAFSQIYKRRRYNLNNHLNASGDSI |
ORF Type | 3prime_partial |
Blastp | NAC domain-containing protein 78 from Arabidopsis with 44.44% of identity |
---|---|
Blastx | NAC domain-containing protein 78 from Arabidopsis with 69.64% of identity |
Eggnog | (NAC) domain-containing protein(ENOG410YG99) |
Kegg | Link to kegg annotations (AT5G04410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441018.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer