Protein coding transcript 220363

• Transcript: Ll_transcript_188737
• CDS coordinates: 784-1449 (+)
• Peptide sequence: MMSFSVDKQSTKGLKSVAHLSMFLACYSKHQAVMYLNIDINLLVRIANLLCISFTGVSPGEGTGATMSDDEDNQVDSDADLFDGGLDGHDSMGFGPLIPTENERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGGTTSVLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKNKRKSNAGDSSADRCM*
• ORF Type: complete

Annotations of Ll_transcript_188737

• Blastp: Homeobox protein knotted-1-like 3 from Arabidopsis with 89.7% of identity
• Blastx: Homeobox protein knotted-1-like 3 from Arabidopsis with 89.7% of identity
• Eggnog: homeobox(ENOG410XPMQ)
• Kegg: Link to kegg annotations (AT5G25220)
• CantataDB: Link to cantataDB annotations (CNT0001697)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415059.1)
• Pfam: ELK domain (PF03789.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;