Protein coding transcript 220401

• Transcript: Ll_transcript_190786
• CDS coordinates: 223-807 (+)
• Peptide sequence: MEVENASVMWQGVMLGAIVFWILCSSYLNFTQKLRSFLQPWVNHHVETGTHVILQIQSYQHRFLDAFFSGLSCVVSVPFYTAFLPLLFWSGHGQLARQMTLLMAFCDYIGNCIKDLVSAPRPPSPPVRRVTATKDEEDNALEYGLPSSHTLNTVCLSGYLSFSSFIVIPIPYPTCNRKGFYAYLYVYQKFCVVL*
• ORF Type: complete

Annotations of Ll_transcript_190786

• Blastp: Lipid phosphate phosphatase delta from Arabidopsis with 76.28% of identity
• Blastx: Lipid phosphate phosphatase delta from Arabidopsis with 74.1% of identity
• Eggnog: PHOsphatase(COG0671)
• Kegg: Link to kegg annotations (AT3G58490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455474.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;