| Transcript | Ll_transcript_190796 |
|---|---|
| CDS coordinates | 501-887 (+) |
| Peptide sequence | MFISYLLHYVLTHTQIQGAYVNYLGVSLVCLFVALIGIGRSSICFKFLATSCYWPIALAQETEKYLALFVGRIYLGMHSLIDILAGLVFGLGILAFWLAVDKQIDSFVISGLNGTLTVLCLINKSSTV* |
| ORF Type | complete |
| Blastp | Lipid phosphate phosphatase delta from Arabidopsis with 34.86% of identity |
|---|---|
| Blastx | Lipid phosphate phosphatase delta from Arabidopsis with 86.11% of identity |
| Eggnog | PHOsphatase(COG0671) |
| Kegg | Link to kegg annotations (AT3G58490) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019455474.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer