Protein coding transcript 220416

• Transcript: Ll_transcript_190772
• CDS coordinates: 175-996 (+)
• Peptide sequence: MELEGLCVVWQGAILGGILFWIFSSSHLNLTQKLRSFLQPWVTHHVQTTTHMVLLIQSYQHGFLDALFSGLSCVVSVPFYTAFLPLLFWSGHGQLARQMTLLMAFCDYIGNCIKDVVSAPRPPSPPVRRVTATKDEEDNALEYGLPSSHTLNTICLSGYLLHYVLTHTQIQGAYVNYLGVSLVCLFVALIGIGRSSICFKFLATSCYWPIALAQETEKYLALFVGRIYLGMHSLVDILAGLVLGLGILAFWLVVDEHIDSFVTSGQNGTLMSN*
• ORF Type: complete

Annotations of Ll_transcript_190772

• Blastp: Lipid phosphate phosphatase delta from Arabidopsis with 59.69% of identity
• Blastx: Lipid phosphate phosphatase delta from Arabidopsis with 58.15% of identity
• Eggnog: PHOsphatase(COG0671)
• Kegg: Link to kegg annotations (AT3G58490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444139.1)
• Pfam: PAP2 superfamily (PF01569.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;