Protein coding transcript 220439

• Transcript: Ll_transcript_190054
• CDS coordinates: 331-1122 (+)
• Peptide sequence: MKDELEREKYPRMPWHDVHCALWGPPCRDIARHFVQRWNYAKRSKAPYEQAIPLLMPQHHMVIPHYLGGSREIQIESSNTGNYKLIKRQGSFSSSSVDHDIPLLLPQEPGELNTLDGDPKLNGVSSFSHRLDKPSRVSSGLPFSFRKPKSEASGSDTPMKGFVDDIDSVHYREKTSLDRVAHADLQNTDSAWWETQERGGQGGFEDESGQVGPRASCRCQVIRSVSQWSAGTSQTEESIHNAYCSLIEKAEYFIYIEDFLEMR*
• ORF Type: complete

Annotations of Ll_transcript_190054

• Blastp: Phospholipase D zeta 1 from Arabidopsis with 60.77% of identity
• Blastx: Phospholipase D zeta 1 from Arabidopsis with 65.31% of identity
• Eggnog: Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol (By similarity)(COG1502)
• Kegg: Link to kegg annotations (AT3G16785)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419033.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;