Protein coding transcript 220452

• Transcript: Ll_transcript_190099
• CDS coordinates: 836-1183 (+)
• Peptide sequence: MDSLSNSPIVFSDTLKSKIGRSMLLKNDKLSENLNFNRAEPQEDSNSLKAEWVEQYEPGVYITLTTLSCGKKGLKRVRFSRKRFSEKEAERWWEGNQATVYHKYDIEGYTDTRQS*
• ORF Type: complete

Annotations of Ll_transcript_190099

• Blastp: Protein Brevis radix-like 4 from Arabidopsis with 59.26% of identity
• Blastx: Protein Brevis radix-like 4 from Arabidopsis with 52.46% of identity
• Eggnog: brevis radix-like(ENOG41116VM)
• Kegg: Link to kegg annotations (AT5G20540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419884.1)
• Pfam: Transcription factor regulating root and shoot growth via Pin3 (PF08381.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;