Protein coding transcript 220490

• Transcript: Ll_transcript_188237
• CDS coordinates: 279-683 (+)
• Peptide sequence: MCMALQLFSPSESRGFLNVLAGYEDGSMLWWDVRNPRVPLTSVKFHSEPVLSICIDGSCNGGISGAADDKIVMYSLEHSTGTCVFKKEISLERPGISGSSIRPDGKIAATAGWDHRIRIYNYRKGNALAILKYHR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_188237

• Blastp: Protein DECREASED SIZE EXCLUSION LIMIT 1 from Arabidopsis with 78.52% of identity
• Blastx: Protein DECREASED SIZE EXCLUSION LIMIT 1 from Arabidopsis with 70.83% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (AT4G29860)
• CantataDB: Link to cantataDB annotations (CNT0001698)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416004.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;