Protein coding transcript 220491

• Transcript: Ll_transcript_188238
• CDS coordinates: 3-581 (+)
• Peptide sequence: RPTNQFLRVGMALSNFGISMMLVCQGTTMSLVIILLLVDPHPPSRIPLLTIETNTYHFCKLSTVKTPSVLSKSGKESEFRRTPNGEIPEDKKEKAYDDQPCFESREDNMHHEGLPYVALSGENSSQVEIWDLKSAERFVQLPSNITSNSSSVCNKDRGMCMALQLFSPSESRGFLNVLAGYNLDPISCVSSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_188238

• Blastp: Protein DECREASED SIZE EXCLUSION LIMIT 1 from Arabidopsis with 42.76% of identity
• Blastx: Protein DECREASED SIZE EXCLUSION LIMIT 1 from Arabidopsis with 42.76% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (AT4G29860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416003.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;