Protein coding transcript 220494

• Transcript: Ll_transcript_188241
• CDS coordinates: 199-939 (+)
• Peptide sequence: MSKRPTPDPVAVLRGHRASVTDVSFHPSNPILFSCSSDGEVRIWDTLQHRTLFSSWLHSAAHGIVSVATTPSLPTNQFLSQGRDGTVKLWDFNDAGLSRIPLLTIETNTYHFCKLSTVKTPSVLSKSGKESEFRRTPNGEIPEDKKEKAYDDQPCFESREDNMHHEGLPYVALSGENSSQVEIWDLKSAERFVQLPSNITSNSSSVCNKDRGMCMALQLFSPSESRGFLNVLAGYNLDPISCVSSS*
• ORF Type: complete

Annotations of Ll_transcript_188241

• Blastp: Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 55.23% of identity
• Blastx: Protein DECREASED SIZE EXCLUSION LIMIT 1 from Nicotiana with 55.23% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416003.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;