Protein coding transcript 220544

• Transcript: Ll_transcript_188421
• CDS coordinates: 1-1077 (+)
• Peptide sequence: SDGHWPAQLTGNLFFLPPLVFCLYITGHLKSIFPEEYRREILRYIYCHQNEDGGWGLHIEGHSIMFCTAFNYTCMRILGEGPNGGQDNACARARKWIQDHGGVTHIPSWGKTWLSILGLFDWRGANPMPPEFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELYTQPYEKTNWKKARHQCAKEDLYYPHPLLQDLIWDSLYILTEPLLTRWPFNKLVRERALQITMNHIHYEDENSRYITNGIMEKILCMLCCWVEDPNGVAFKKHLARIPDYLWVSEDGMTVQGLSSQGWDASFIVQALFASNLVDEIGPTLAKGHDFIKRSQVRDNPQGDFKSMHRHISK
• ORF Type: internal

Annotations of Ll_transcript_188421

• Blastp: Beta-amyrin synthase from Glycyrrhiza with 87.19% of identity
• Blastx: Beta-amyrin synthase from Glycyrrhiza with 87.19% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAA89815)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432607.1)
• Pfam: Squalene-hopene cyclase N-terminal domain (PF13249.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;