Protein coding transcript 220614

• Transcript: Ll_transcript_189648
• CDS coordinates: 1-330 (-)
• Peptide sequence: KKGYQPNDATVTVLVNSLCKRGKIKKAMEVFEVVGSKGVKVYNCLLKGLCYVGKVEEALECLMSMKEKKLKNQFLEPDVYSYTAVMDGLCKVGRSDEAMGLLNEAVEMGL
• ORF Type: internal

Annotations of Ll_transcript_189648

• Blastp: Pentatricopeptide repeat-containing protein At1g64583, mitochondrial from Arabidopsis with 36.04% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g64583, mitochondrial from Arabidopsis with 36.04% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G64583)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416406.1)
• Pfam: PPR repeat (PF12854.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;