Protein coding transcript 220734

• Transcript: Ll_transcript_188312
• CDS coordinates: 3304-3630 (+)
• Peptide sequence: MLGNAAVPTLTLILGANLLKGLRGTSNPPLWTVVGIIVVRYIFLPLMGIGVVKGAIYLGLVQPNPLYQFVLLLQYALPPAMNIGTIAQLFGAGESECSVIMLWAYALAS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_188312

• Blastp: Protein PIN-LIKES 1 from Arabidopsis with 63.64% of identity
• Blastx: Protein PIN-LIKES 1 from Arabidopsis with 60.99% of identity
• Eggnog: Auxin Efflux Carrier(COG0679)
• Kegg: Link to kegg annotations (AT1G20925)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446919.1)
• Pfam: Membrane transport protein (PF03547.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;