Protein coding transcript 220739

• Transcript: Ll_transcript_188323
• CDS coordinates: 405-1184 (+)
• Peptide sequence: MGFLQLFYVASLPVIKVLLITAIGLFLALDNINLLGEDARKKVNHIVFYVFNPSLVGGSLASTLTLESIVMLWFMPINILGTFILGSALGWILIKITRPPKHMEGLVLGCCSAGNLGNLLIIIIPAICKEKGSPFGEPDVCNQYGMAYASLSMAIGAIFIWTYVYNIMRISANKLHKEVNTSNDHSILKGSEEISESQQDSYSGTLNSAKYEVDDAYTILLSNTESEEKVKLSTNLLYSDYNFRVVLFCRYCIIRDSHL*
• ORF Type: complete

Annotations of Ll_transcript_188323

• Blastp: Protein PIN-LIKES 3 from Arabidopsis with 50.82% of identity
• Blastx: Protein PIN-LIKES 3 from Arabidopsis with 50.82% of identity
• Eggnog: Auxin Efflux Carrier(COG0679)
• Kegg: Link to kegg annotations (AT1G76520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446918.1)
• Pfam: Membrane transport protein (PF03547.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;