Protein coding transcript 220745

• Transcript: Ll_transcript_188326
• CDS coordinates: 193-1071 (+)
• Peptide sequence: MAASILNMLTTIPFSKSQLESTTYTKFPTTASSLSLTQNSLSTIRKLTSCKTNLHETSSSFSSLNQEAVEEEEAQKLEDHLQLPQAWREIHGENDWIGLLDPMNPLLRSELIRYGEMAQSCYDAFDFDPFSKYCGSCRFTPPNFFDSLGMHHHGYNVTRYLYATANINLPNFFKHSRWSKMWSKHANWAGYVAVSNDGTSKRIGRRDITIAWRGTVTYLEWIADLMDILKPISANSIPCPDQSVKWINQKSLKEQMNAQLTNRGRRRKQQFGINKTFLNVPLSNINLGYSFA*
• ORF Type: complete

Annotations of Ll_transcript_188326

• Blastp: Phospholipase A1-Igamma1, chloroplastic from Arabidopsis with 55.74% of identity
• Blastx: Phospholipase A1-Igamma2, chloroplastic from Arabidopsis with 71.35% of identity
• Eggnog: galactolipase activity(ENOG410XP1I)
• Kegg: Link to kegg annotations (AT1G06800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451205.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;