Protein coding transcript 220802

• Transcript: Ll_transcript_188999
• CDS coordinates: 1-618 (+)
• Peptide sequence: QRQNYNRPSVILTHPFPFSYQFSSSSLFLSFSLYPFPFFIFILHPFSDLDLTHFSILSNPLKFHTFLFHSIYLSTKMSSLLSDLSIRIYPEPDRSELDHFDRLPDSILLLVFNNIADVKALGRCCVVSRRFHALVPQVENVVVRVDCVISDDDSNSSNSSSDKTRGTFSNLFRLVFGGIVKPLQALGQLLGPKRTALVSGSSSSSP
• ORF Type: internal

Annotations of Ll_transcript_188999

• Blastp: F-box protein At5g46170 from Arabidopsis with 69.23% of identity
• Blastx: F-box protein At5g46170 from Arabidopsis with 69.23% of identity
• Eggnog: NA(ENOG41119HQ)
• Kegg: Link to kegg annotations (AT5G46170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419888.1)
• Pfam: F-box-like (PF12937.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;