Protein coding transcript 220828

• Transcript: Ll_transcript_188785
• CDS coordinates: 3-878 (+)
• Peptide sequence: KKCEFSFSFIASCFQQTQASGASSIISLHWRWCCLEYRHRTQDSHIKIHRPYCFFYPSEFIVMHKEKSATLTALELHDRLTRSQAASISESRQLPTSKGVTQQNQKQSKGANPERPVSDNTRLGHKKRGVLQDVTNSSCFNATTIQTKKSKSTEAAQLEVSIAVQSVAMEQPQIQVGSNAKVLPEIGLRSEDVTCSVNLQHNALDSQTLISQKKVLQVVEAKKVNLFGAPNIAKDPDVIDIDADFEDPLFCTIYAVDIYDNLRVAEVCLINAPPVVYTSLLVSIAFLSVPL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_188785

• Blastp: Cyclin-A2-4 from Arabidopsis with 29.15% of identity
• Blastx: Cyclin-A2-4 from Arabidopsis with 75.94% of identity
• Eggnog: g2 mitotic-specific(COG5024)
• Kegg: Link to kegg annotations (AT1G80370)
• CantataDB: Link to cantataDB annotations (CNT0000534)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436397.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;