Transcript | Ll_transcript_188764 |
---|---|
CDS coordinates | 172-1515 (+) |
Peptide sequence | MKKENSVVLKAGEFPGRMTRAQVASSRVSRQLAPLKEPSRRNQNQPLCADPKRAVSDTGSTCLQHKKRVVLQDVTDVCCQNSYKSCFDSTITQAKKRKVVKDSRINVAKVAPSVALELPQPQSNSEDAICSTNLGNNSLLKLSSNKCDKDDSTSGTSAPPTDSKKKTKKGNFYELLVASKGPVITDIDDNFEDPQLCSHYVTDIYNNLRVAELARRPHPNSMETVQQDITQSMRGILVDWLVEVSEEYKLGLDTLYLSVYLIDWFLSKCYVERQRLQLLGVTCMLIASKYEEINAPHIEDFCFITDNTYSKAEVLTMESQVLKLSEYKLFAPTTITFLRRFLHAAEASSYKSPNLELEYLASYIAELALMDYGFLNFLPSIIAASAVFLARWTLDQSNHPWNPTLEHYASYKASDLKTTVLALQDLQLNTNGCPLTAVRSKYRQDKV* |
ORF Type | complete |
Blastp | Cyclin-A2-4 from Arabidopsis with 51.89% of identity |
---|---|
Blastx | Cyclin-A2-4 from Arabidopsis with 52.1% of identity |
Eggnog | g2 mitotic-specific(COG5024) |
Kegg | Link to kegg annotations (AT1G80370) |
CantataDB | Link to cantataDB annotations (CNT0000534) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425110.1) |
Pfam | Cyclin, N-terminal domain (PF00134.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer