Protein coding transcript 220830

• Transcript: Ll_transcript_188786
• CDS coordinates: 172-915 (+)
• Peptide sequence: MKKENSVVLKAGEFPGRMTRAQVASSRVSRQLAPLKEPSRRNQNQPLCADPKRAVSDTGSTCLQHKKRVVLQDVTDVCCQNSYKSCFDSTITQAKKRKVVKDSRINVAKVAPSVALELPQPQSNSEDAICSTNLGNNSLLKLSSNKCDKDDSTSGTSAPPTDSKKKTKKGNFYELLVASKGPVITDIDDNFEDPQLCSHYVTDIYNNLRVAELARRPHPNSMETVQQDITQSMRGILVDWLVEVCII*
• ORF Type: complete

Annotations of Ll_transcript_188786

• Blastp: Cyclin-A2-4 from Arabidopsis with 35.63% of identity
• Blastx: Cyclin-A2-4 from Arabidopsis with 36.9% of identity
• Eggnog: g2 mitotic-specific(COG5024)
• Kegg: Link to kegg annotations (AT1G80370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425110.1)
• Pfam: Cyclin, N-terminal domain (PF00134.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;