Protein coding transcript 220833

• Transcript: Ll_transcript_188767
• CDS coordinates: 1-555 (+)
• Peptide sequence: CIFVIPIMQKFIITLFYKVMHVAFGLFKLINNVWQVLRMESQVLKLSEYKLFTPTTITFLRRFLRAAQASYKSPSLELEYLASYLAELTLMDYDFLNFLPSIIAASVVFLAKWTLDQSNHPWNPTLEHYAHYKASDLKTIVFALQDLQLNTNGCPLNAVRSKYRQEKFKCVADLSSPKLIETLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_188767

• Blastp: Cyclin-A2-3 from Arabidopsis with 74.67% of identity
• Blastx: Cyclin-A2-3 from Arabidopsis with 74.67% of identity
• Eggnog: g2 mitotic-specific(COG5024)
• Kegg: Link to kegg annotations (AT1G15570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425110.1)
• Pfam: Cyclin, C-terminal domain (PF02984.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;