Protein coding transcript 220855

• Transcript: Ll_transcript_190472
• CDS coordinates: 656-1408 (+)
• Peptide sequence: MDSDDLRSILDSSGVDVWSFIDTAIAVAATDSGGELKRRRDAIVERLYSATTAPPRCRNCDGDNRSVVTANGDQVRRQQRTRSPSPKRQSPQREQRRRFATSPETPQSLENDDDENDTDLDPYGGLFDDEQKKILEIKELLEEPDQSEDSLVDLLQNLADMDITFQALRETDIGRNVNRLRKHSSNDVRRLVKLLVRKWKETVDEWVKSNPQGEAATLMADGDSSPLQKTTQNGHHHVKEIFCVYFYYES*
• ORF Type: complete

Annotations of Ll_transcript_190472

• Blastp: Probable mediator of RNA polymerase II transcription subunit 26c from Arabidopsis with 55.37% of identity
• Blastx: Probable mediator of RNA polymerase II transcription subunit 26c from Arabidopsis with 54.59% of identity
• Eggnog: Transcription elongation(ENOG411201A)
• Kegg: Link to kegg annotations (AT5G09850)
• CantataDB: Link to cantataDB annotations (CNT0000464)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417446.1)
• Pfam: TFIIS helical bundle-like domain (PF08711.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;