Transcript | Ll_transcript_190481 |
---|---|
CDS coordinates | 259-936 (+) |
Peptide sequence | MDSEEFRSILEASGVDVWSLIDTAIVVAATDSGEELKRRRDGIIERLYSVPAVPPRCRNCDGVVGGGNCSVVTANGYEFKKQQRSPSPIRQPPQREQQRRFASSPETPQSPDNDENENENDLDPFGGLFDDEQKKILEIKEQLEEPDQSEESLVELLQNLVDMDITFQALKETDIGRHVNQLRKHSSNDVRRLVKLLVKKWKEIVDEWVKSNPVGKTATLMGNVE* |
ORF Type | complete |
Blastp | Probable mediator of RNA polymerase II transcription subunit 26c from Arabidopsis with 55.35% of identity |
---|---|
Blastx | Probable mediator of RNA polymerase II transcription subunit 26c from Arabidopsis with 55.81% of identity |
Eggnog | Transcription elongation(ENOG411201A) |
Kegg | Link to kegg annotations (AT5G09850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430922.1) |
Pfam | TFIIS helical bundle-like domain (PF08711.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer