Protein coding transcript 220944

• Transcript: Ll_transcript_190149
• CDS coordinates: 404-985 (+)
• Peptide sequence: MYRPVATSAVPRSEFPNGNGDSVVILDQIPWWIDAENSLGYDNGDSSSYFPDPLASQLGTESDGSGLVSRFPVHHEVNSRIYLWWGNPWNLEVDAVVNSTNEILDEAHSSPGLHAAAGPSLAEECATLGGCRTGMAKITNAYDLPARFEYGPPTTFTTFFKGHRQYRLHYHIGRPVQLCNCGKLSILLAQSML*
• ORF Type: complete

Annotations of Ll_transcript_190149

• Blastp: Protein GDAP2 homolog from Nematostella with 50% of identity
• Blastx: Protein GDAP2 homolog from Nematostella with 50% of identity
• Eggnog: appr-1-p processing domain protein(COG2110)
• Kegg: Link to kegg annotations (NEMVE_v1g195342)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017426062.1)
• Pfam: Macro domain (PF01661.20)
• Rfam: -
• GO: -