| Transcript | Ll_transcript_190157 |
|---|---|
| CDS coordinates | 1588-2634 (+) |
| Peptide sequence | MLWCPGTVRRFLEKQKDNITAVVFCTTNTTDTEIYKRLLPLYFPRDKHEEEVALSKLPADVGDENGETVIDERKIRIKPLPKKNIPKPPVDLPVSDVGLVRRTSSYLDTFLDPAFMSLIKDPDERRLEQWEKTVQAQRGWNVAKLLGLGDLGGPSLSAAEEYSLHSRYLSKANSLNLSEIAEMKIVYRGGVDSEGRPVMVVVGAHFLLRCLDLERFVLYVVKEFEPIIQKPYTIVYFHSAASLQMQPDMGWMRRLQEILGRKHQHNLHAIYVLHPTLGLKVAVFGLQLLVDAAVWKKVVYVDRLLQLFRYVPREQLTIPDFVFQHDLEVNGGKGLIVDPRTKYVYQRP* |
| ORF Type | complete |
| Blastp | Ganglioside-induced differentiation-associated protein 2 from Danio with 34.34% of identity |
|---|---|
| Blastx | Ganglioside-induced differentiation-associated protein 2 from Danio with 34.34% of identity |
| Eggnog | appr-1-p processing domain protein(COG2110) |
| Kegg | Link to kegg annotations (447824) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456715.1) |
| Pfam | Divergent CRAL/TRIO domain (PF13716.5) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer