Transcript | Ll_transcript_190124 |
---|---|
CDS coordinates | 301-882 (+) |
Peptide sequence | MYRPVSTSAIPRGGLPNDNGDSVVTLDQVPRWIDAEYSVGYDNEDSTSYFPDPLASQPGTDSGGSGSVSRFPVDHEVNSRIYLWRGNPWNLEVDAVVNSTNEVLDEAHSSPGLHAAAGPSLAEECATLGGCRTGMAKITNAYDLPARFEYGPPTTFTTFFKGHRQYRLHYHIGRPVQLCNCGKLSILLAQSML* |
ORF Type | complete |
Blastp | Protein GDAP2 homolog from Nematostella with 40.77% of identity |
---|---|
Blastx | Protein GDAP2 homolog from Nematostella with 40.77% of identity |
Eggnog | appr-1-p processing domain protein(COG2110) |
Kegg | Link to kegg annotations (NEMVE_v1g195342) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456715.1) |
Pfam | Macro domain (PF01661.20) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer