Transcript | Ll_transcript_188676 |
---|---|
CDS coordinates | 3-431 (+) |
Peptide sequence | AGGKTLLIPIDHGYCLPEKFEDCTFDWLYWPQASQPYSPETVDYIKSLDAEEDIELLKYYGWEVPLECARTLRVSTMLLKKGVEKGLSPYAIGSIMCRENLNKESVIEEIICEAQESLLPGYEESEFLQSVSQIMNSYLEKL* |
ORF Type | 5prime_partial |
Blastp | Phosphatidylinositol 4-kinase gamma 2 from Arabidopsis with 65% of identity |
---|---|
Blastx | Phosphatidylinositol 4-kinase gamma 4 from Arabidopsis with 64.71% of identity |
Eggnog | Phosphatidylinositol 4-kinase type(ENOG410XP06) |
Kegg | Link to kegg annotations (AT1G64460) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421320.1) |
Pfam | Phosphatidylinositol 3- and 4-kinase (PF00454.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer