Protein coding transcript 221018

• Transcript: Ll_transcript_188665
• CDS coordinates: 46-639 (+)
• Peptide sequence: MASSILSIICTTCVIIFLAATSICVVEGGREFKVGDHLGWHEPVPTNGIFYIQWAERNRFQVGDSLLFEYQNDSVLSVEKTYYLNCNASNPITAFDNGKSIMNLDRPGPFYFINGTEHYCTNGQKLLVEVMSQRPIPKSSPSPSISLPPEGSSQMSPSAYASDDSIDDSTSASDSVVLGPVPMASLATFLIVLMLKP*
• ORF Type: complete

Annotations of Ll_transcript_188665

• Blastp: Early nodulin-like protein 2 from Arabidopsis with 43.7% of identity
• Blastx: Early nodulin-like protein 2 from Arabidopsis with 43.7% of identity
• Eggnog: Plastocyanin-like domain(ENOG411137T)
• Kegg: Link to kegg annotations (AT4G27520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457186.1)
• Pfam: Plastocyanin-like domain (PF02298.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;