| Transcript | Ll_transcript_190015 |
|---|---|
| CDS coordinates | 101-493 (+) |
| Peptide sequence | MQRRIVGLHQTTSIGSTDITDTWEPLEEGLLPLETTRHVSMITITLSKNELDTSSVGYQSPIPADQVKPSTDFDYEGEGSPNGRGRGRGGRGRGRARGMCCDCVCFLHIKHKKHYVYELFVITGIIINCN* |
| ORF Type | complete |
| Blastp | Ribonuclease P protein subunit p25-like protein from Mus with 41.27% of identity |
|---|---|
| Blastx | - |
| Eggnog | ribonuclease P MRP 25kDa(ENOG4111WGZ) |
| Kegg | Link to kegg annotations (69961) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453330.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer