Protein coding transcript 221092

• Transcript: Ll_transcript_189544
• CDS coordinates: 2-472 (+)
• Peptide sequence: QNLLVNPQSHQIKICDFGSAKKLVSGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKILGSPTREEIKCMNPNYTEFKFPQIKAHPLHKVFHKTVPSEAVDLASRMLQYSPNLRCTAVRKLLFILE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_189544

• Blastp: Shaggy-related protein kinase gamma from Arabidopsis with 84.87% of identity
• Blastx: Shaggy-related protein kinase NtK-1 from Nicotiana with 87.16% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G05840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433952.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;