Transcript | Ll_transcript_189549 |
---|---|
CDS coordinates | 2-607 (+) |
Peptide sequence | QNLLVNPQSHQIKICDFGSAKKLVSGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKILGSPTREEIKCMNPNYTEFKFPQIKAHPLHKVFHKTVPSEAVDLASRMLQYSPNLRCTALEACAHPFFDDLRDPKVTLPNGRPMLTLFDFTAQELAGAPDELRRRLIPEHARS* |
ORF Type | 5prime_partial |
Blastp | Shaggy-related protein kinase theta from Arabidopsis with 83.08% of identity |
---|---|
Blastx | Shaggy-related protein kinase theta from Arabidopsis with 83.08% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G00720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433952.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer