Protein coding transcript 221102

• Transcript: Ll_transcript_189907
• CDS coordinates: 1318-1887 (+)
• Peptide sequence: MTQLDYHPFTLNQNLDHNIIGYDSDLIGQIDFNQHHNPEIKDSESTEFIFDEGFDCSQFFGEDDAGNGGEEVIPNILPNICPPPSAFLSPKCALWDCFRPAQGLTYCLDYCSSGHELLANNEGLPGTTPILRPGGIDVKDGPLLAAVRAKTQGKEVGIPKCEGAASTKSPWNAPGEYAIGLFLFMHLTF*
• ORF Type: complete

Annotations of Ll_transcript_189907

• Blastp: Transcription factor VOZ1 from Arabidopsis with 68.63% of identity
• Blastx: Transcription factor VOZ1 from Arabidopsis with 77.95% of identity
• Eggnog: one zinc finger protein(ENOG410YAZS)
• Kegg: Link to kegg annotations (AT1G28520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413456.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;