Transcript | Ll_transcript_188621 |
---|---|
CDS coordinates | 874-1284 (+) |
Peptide sequence | MVFLCADKFGAAMALVKSDIGGNISRLESKYASNPSRFNYLYSLVQVEVETKTAKSSSSCTNGLLWLTRAMDFLVELFRNLIEHEDWSMSQACTNSYNKTLKKWHGWLASSSFTVMLLSYFIFLIILKFLDRNRTF* |
ORF Type | complete |
Blastp | Glycolipid transfer protein 1 from Arabidopsis with 76.58% of identity |
---|---|
Blastx | Glycolipid transfer protein 1 from Arabidopsis with 76.58% of identity |
Eggnog | glycolipid transport(ENOG410YFEA) |
Kegg | Link to kegg annotations (AT2G33470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432740.1) |
Pfam | Glycolipid transfer protein (GLTP) (PF08718.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer