Protein coding transcript 221116

• Transcript: Ll_transcript_188637
• CDS coordinates: 620-1201 (+)
• Peptide sequence: MEGTVFAPAIEGIKTVKSDQGEILSQPFLEVCKHILPVIDKFGAAMALVKSDIGGNISRLESKYASNPSRFNYLYSLVQVEVETKTAKSSSSCTNGLLWLTRAMDFLVALFRNLIDHEDWSMSQACTDSYTKTLKKWHGWLASSSFTVAMKLAPDRKKFMDVVGGTGDINADIEQFCSAFSPLLEENHKFLVK*
• ORF Type: complete

Annotations of Ll_transcript_188637

• Blastp: Glycolipid transfer protein 1 from Arabidopsis with 74.35% of identity
• Blastx: Glycolipid transfer protein 1 from Arabidopsis with 74.35% of identity
• Eggnog: glycolipid transport(ENOG410YFEA)
• Kegg: Link to kegg annotations (AT2G33470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432740.1)
• Pfam: Glycolipid transfer protein (GLTP) (PF08718.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;