Protein coding transcript 221182

• Transcript: Ll_transcript_190207
• CDS coordinates: 1-369 (-)
• Peptide sequence: NYSKREECTIKKSKAERAKRRHSDRNRRGKNELDTALVTDVNNYRIFAATWNVGGKSPPSHLSLEDWLLTSPSADIYVLGFQEIVPLNAGNVLGTEDNGPATKWLSLIRKTLNSLPGTNSEYH
• ORF Type: internal

Annotations of Ll_transcript_190207

• Blastp: Type I inositol polyphosphate 5-phosphatase 4 from Arabidopsis with 63.93% of identity
• Blastx: Type I inositol polyphosphate 5-phosphatase 4 from Arabidopsis with 63.93% of identity
• Eggnog: inositol(COG5411)
• Kegg: Link to kegg annotations (AT3G63240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426611.1)
• Pfam: Endonuclease/Exonuclease/phosphatase family (PF03372.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;