Protein coding transcript 221223

• Transcript: Ll_transcript_187832
• CDS coordinates: 42-695 (+)
• Peptide sequence: MSSLAPYSLWTSLQPKKATNYSSPKSSNLVSCNYNHHKTLSTSHSLVLLQNDETNPLSQLRRRDALTLSLSLGLLHAFFYPQQTLAAVEEVPCQLTVAPSGLAFCDKVLGTGSQAVKGQLIKAHYVGRLENGKVFDSSYNRGKPLTFRVGIGEVIKGWDEGILGGDGVPPMLAGGKRTLKLPPELAYGSRGAGCKGGSCVIPPDSVLLFDVEFVSKA*
• ORF Type: complete

Annotations of Ll_transcript_187832

• Blastp: Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic from Arabidopsis with 57.01% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic from Arabidopsis with 78.03% of identity
• Eggnog: Peptidyl-prolyl cis-trans isomerase(COG0545)
• Kegg: Link to kegg annotations (AT5G45680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462527.1)
• Pfam: FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;