Protein coding transcript 221247

• Transcript: Ll_transcript_189501
• CDS coordinates: 2-673 (+)
• Peptide sequence: NDDGEEEEEQEEEQEEEEEELDRNSNMDLPGDDEDLRRSRRRREVLRLRIRDLAMRTRSMRNRILDWSDILSGLDDNSIQFRLQVPESDRYVGNPEDYVDAAEYEALLQTLAETDGGGKKGAPPAAKSAVEALPTVEIVSEKEVVACAICKDMVGVGDVAKRLPCGHQYHGDCIVPWLGSRNSCPICRFELPTEDKEYEQQRKNKKVMNSSSNGASGSGGGSG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_189501

• Blastp: E3 ubiquitin-protein ligase CIP8 from Arabidopsis with 60.61% of identity
• Blastx: E3 ubiquitin-protein ligase CIP8 from Arabidopsis with 60.9% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G64920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452604.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;