Protein coding transcript 221280

• Transcript: Ll_transcript_188013
• CDS coordinates: 392-1429 (+)
• Peptide sequence: MNCRCSLPPESLFNSSSMVSLSSNSAAGEEGRVVSDLNRPLSHTLAPSFWIRMAMRISRARWFGFLRRVFHYQNGPSSHHGTNPFDSSTWMMLEFIALVVQIITTTSTLVISKRERPVWPMRIWATSYDIGCVLNLLLLYGRYRQIYLIPGDTLHLSHLEHQRNNEETRIPHLMNKCKTSVELFFAVWFVMGNVWIFESSRFGYFNEAPKLHVLCITLLGWNAICYSFPFLLFLLLCCCVPLINRLLGYNMVSSDKGATHDQISQLPSWTHQQVHTKLELGNDTEGCHKLINQDPECCICLAKYKEKEEVRELPCSHIFHQKCVDQWLKIISCCPLCKQGLERTK*
• ORF Type: complete

Annotations of Ll_transcript_188013

• Blastp: E3 ubiquitin-protein ligase At4g11680 from Arabidopsis with 30.15% of identity
• Blastx: Calcineurin B-like protein 2 from Arabidopsis with 87.1% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G11680)
• CantataDB: Link to cantataDB annotations (CNT0002341)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456046.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;