Protein coding transcript 221287

• Transcript: Ll_transcript_187992
• CDS coordinates: 2680-3360 (+)
• Peptide sequence: MLQCIEGILHLFYPILRCCDLDLNKQQTGLKDPEVLARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIGFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT*
• ORF Type: complete

Annotations of Ll_transcript_187992

• Blastp: Calcineurin B-like protein 3 from Oryza sativa with 91.59% of identity
• Blastx: Calcineurin B-like protein 3 from Oryza sativa with 91.59% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (4333502)
• CantataDB: Link to cantataDB annotations (CNT0002341)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456046.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;