Protein coding transcript 221392

• Transcript: Ll_transcript_9425
• CDS coordinates: 618-1310 (+)
• Peptide sequence: MHAMWKPQKFKYIYLLATLYVFTLTIPSAVAVYWAFGDALLNHSNAFSLLPKNGFRDAAVILMLIHQFITFGFASTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPFFIPSWTAMYVLNAFIVVWVFVVGFGFGGWASMTNFVRQIDTFGLFAKCYQCKPPVPPHVVVAPPPRAHH*
• ORF Type: complete

Annotations of Ll_transcript_9425

• Blastp: Auxin transporter protein 1 from Arabidopsis with 93.46% of identity
• Blastx: Auxin transporter protein 1 from Arabidopsis with 93.49% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT2G38120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430187.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;