Protein coding transcript 221408

• Transcript: Ll_transcript_10373
• CDS coordinates: 1-399 (+)
• Peptide sequence: IASTVVEDLIRSVHIKGRDALGKPGNITSYVVVTHQHSTIKRAIDRLLFLHKGKLVWEGMTNEFMTSTNPIVQQVGVSCIGPPFLNAFFPCCLKFYFSGASSLKVRLSLMHETYSIRSYVSTLIINCGHYLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_10373

• Blastp: Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic from Arabidopsis with 70.24% of identity
• Blastx: Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic from Arabidopsis with 70.24% of identity
• Eggnog: lipid transport(COG1127)
• Kegg: Link to kegg annotations (AT1G65410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462311.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;