Transcript | Ll_transcript_10394 |
---|---|
CDS coordinates | 338-997 (+) |
Peptide sequence | MIEQFINFVIRPPRAEYNPDQYLWEKEFTLAGKTYQRQDLELVNARGHTLQCSHYLPSPLPEDTSLPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKEDLKMVVSHLRSNKQVSCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELADVYNIRLPKFTVKMAVHYMRRVIEKRAKFDIMDLNCLQV* |
ORF Type | complete |
Blastp | Uncharacterized protein YqkD from Bacillus with 31.86% of identity |
---|---|
Blastx | Uncharacterized protein YqkD from Bacillus with 31.86% of identity |
Eggnog | Hydrolase(COG1073) |
Kegg | Link to kegg annotations (BSU23640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440077.1) |
Pfam | Serine aminopeptidase, S33 (PF12146.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer