Protein coding transcript 221417

• Transcript: Ll_transcript_10382
• CDS coordinates: 665-1324 (+)
• Peptide sequence: MIEQFINFVIRPPRAEYNPDQYLWEKEFTLAGKTYQRQDLELVNARGHTLQCSHYLPSPLPEDTSLPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKEDLKMVVSHLRSNKQVSCIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLYDLMMELADVYNIRLPKFTVKMAVHYMRRVIEKRAKFDIMDLNCLQV*
• ORF Type: complete

Annotations of Ll_transcript_10382

• Blastp: Uncharacterized protein YqkD from Bacillus with 31.86% of identity
• Blastx: Uncharacterized protein YqkD from Bacillus with 31.86% of identity
• Eggnog: Hydrolase(COG1073)
• Kegg: Link to kegg annotations (BSU23640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440077.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;