| Transcript | Ll_transcript_10389 |
|---|---|
| CDS coordinates | 126-629 (+) |
| Peptide sequence | MIEQFINFVIRPPRAEYNPDQYLWEKEFTLAGKIYQRQDLELKNARGHTLQCSHYLPSPLPEDTSLPCVIYCHGNSGCRVDANEAAVLLLPSNITVFTLDFSGSGLSDGDHVSLGWHEKEDLKMVVSHLRSNKQVSHIGLWGRSMGAVTRYYIFQLTCLMYVRNFVL* |
| ORF Type | complete |
| Blastp | Uncharacterized protein YqkD from Bacillus with 30.77% of identity |
|---|---|
| Blastx | - |
| Eggnog | Hydrolase(COG1073) |
| Kegg | Link to kegg annotations (BSU23640) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019420111.1) |
| Pfam | Serine aminopeptidase, S33 (PF12146.7) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer