Protein coding transcript 221433

• Transcript: Ll_transcript_9944
• CDS coordinates: 100-882 (+)
• Peptide sequence: MSGYPNQPPSYGYGAPPPPQTYGAPPPSQSYGAPPPSQSYGAPPPSAQPYSASSYGGPPPPSAPYASSPYSSSSGGPTKPPKDQSYSYGAGGGSYPPAPAYASPFAALVPSAFPPGTDPNVIACFQMADADGSGLIDDKEMQRALSSYNQSFSLRTVHLLMYHFTNTNINKIGPKEFTSLFYSLQNWRGIFERFDKDRSGKIDSTELRDALLSLGYAVSPLVLDLLVSKFDKTGGKSRAIEYDNFIEYGFRTNFFFFYCI*
• ORF Type: complete

Annotations of Ll_transcript_9944

• Blastp: Probable calcium-binding protein CML49 from Arabidopsis with 59.77% of identity
• Blastx: Probable calcium-binding protein CML49 from Arabidopsis with 81.12% of identity
• Eggnog: grancalcin, EF-hand calcium binding protein(ENOG410YKQK)
• Kegg: Link to kegg annotations (AT3G10300)
• CantataDB: Link to cantataDB annotations (CNT0002570)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442952.1)
• Pfam: EF hand (PF13202.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;