Protein coding transcript 221465

• Transcript: Ll_transcript_8964
• CDS coordinates: 160-678 (+)
• Peptide sequence: MISGGGGRSSSTSSTSSWAPTTWVSASGKRIQREMMELNNDPPRDCSAGPKGDNLYHWIATIIGTPGTPYQGGIFFLDIIFPTDYPFKPPQVIFKTRIYHCNVDPDGHVSMGILKDGWSPALTITKVLLAVRSILTNPDPYNAVVPGIAHLYLGDRAKHDDIAAECTVRFAK*
• ORF Type: complete

Annotations of Ll_transcript_8964

• Blastp: Constitutive photomorphogenesis protein 10 from Arabidopsis with 66.85% of identity
• Blastx: Constitutive photomorphogenesis protein 10 from Arabidopsis with 74.48% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT3G13550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431743.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;