Transcript | Ll_transcript_8964 |
---|---|
CDS coordinates | 160-678 (+) |
Peptide sequence | MISGGGGRSSSTSSTSSWAPTTWVSASGKRIQREMMELNNDPPRDCSAGPKGDNLYHWIATIIGTPGTPYQGGIFFLDIIFPTDYPFKPPQVIFKTRIYHCNVDPDGHVSMGILKDGWSPALTITKVLLAVRSILTNPDPYNAVVPGIAHLYLGDRAKHDDIAAECTVRFAK* |
ORF Type | complete |
Blastp | Constitutive photomorphogenesis protein 10 from Arabidopsis with 66.85% of identity |
---|---|
Blastx | Constitutive photomorphogenesis protein 10 from Arabidopsis with 74.48% of identity |
Eggnog | ubiquitin-conjugating enzyme(COG5078) |
Kegg | Link to kegg annotations (AT3G13550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431743.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer