Transcript | Ll_transcript_9275 |
---|---|
CDS coordinates | 221-733 (+) |
Peptide sequence | MLIDCKHFKSGNGNCPFGNICFYKHTVKPGSYTWIHNRPPPQRRPNNYDMYDMLDMLSEVNLSSEELYSIMRGSGLYNDMDPFEMMAISDAMASGDGPCLGPFDSDDDEVNMDFSRMTSLSEALASGVDDIGPEDFGNDEMAHMEAALLSMMMHSNIEEEEEEEYSDEYY* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase makorin from Arabidopsis with 71.43% of identity |
---|---|
Blastx | - |
Eggnog | Ring finger protein(ENOG410XRM0) |
Kegg | Link to kegg annotations (AT3G08505) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425357.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer